What is VIP?
VIP (vasoactive intestinal peptide) is a 28-amino-acid neuropeptide first isolated from pig intestine in 1970 by Sami Said and Viktor Mutt. It belongs to the glucagon/secretin family and is made by nerve cells throughout the body. It acts on the receptors VPAC1 and VPAC2 and is studied for its roles in widening blood vessels, relaxing smooth muscle, gut secretion, immune signalling and the body clock.
VIP product specifications
- Compound: VIP (vasoactive intestinal peptide)
- Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 (28 amino acids, C-terminal amide)
- Molecular formula: C147H238N44O42S
- Molecular weight: about 3325.8 g/mol
- Vial sizes: 5mg, 6mg and 10mg
Regulatory status
A synthetic form of VIP (aviptadil) is approved in some European countries only as part of a combination medicine. It is not approved by the US FDA. This product is a research chemical, not a medicine, and is sold for laboratory research use only.
Related research peptides
- LL-37 is another peptide studied in immune signalling research.
Available sizes: 5mg, 6mg and 10mg
VIP is offered in three vial sizes: 5mg, 6mg and 10mg. All contain the same peptide. The figure is the total amount of peptide in the vial, supplied as a dry (lyophilised) powder; it is not a concentration, so a larger vial is not “stronger”, it simply holds more material. Tell us which size you need when you contact us on Telegram or by email.
Handling and research-use notice
Store and handle this material as stated on the label and certificate of analysis for your batch; see our guide to storing research peptides. This product is sold for laboratory research use only. It is not a medicine or supplement and is not for human or veterinary use.
