What is FOXO4-DRI?
FOXO4-DRI is a synthetic peptide made of D-amino acids in reverse order (a “D-retro-inverso” design), which makes it more resistant to breakdown by enzymes. It was designed to block the interaction between the proteins FOXO4 and p53 in senescent cells, which are cells that have stopped dividing. In the study that introduced it, this caused senescent cells to die in culture and in aged mice (Baar et al., Cell, 2017).
FOXO4-DRI product specifications
- Compound: FOXO4-DRI
- Sequence (D-amino acids): LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (46 amino acids)
- Molecular formula: C228H388N86O64
- Molecular weight: about 5358.1 g/mol
- CAS number: 2460055-10-9
- Vial sizes: 2mg and 10mg
Regulatory status
FOXO4-DRI is not an approved medicine in the US, UK, EU or Canada and has no published human clinical trials. This product is sold for laboratory research use only.
Related research peptides
- Epithalon is a short peptide studied in ageing research.
- Humanin is a mitochondrial peptide studied in cell survival research.
Available sizes: 2mg and 10mg
FOXO4-DRI is offered in two vial sizes: 2mg and 10mg. Both contain the same peptide. The figure is the total amount of peptide in the vial, supplied as a dry (lyophilised) powder; it is not a concentration, so a larger vial is not “stronger”, it simply holds more material. Tell us which size you need when you contact us on Telegram or by email.
Handling and research-use notice
Store and handle this material as stated on the label and certificate of analysis for your batch; see our guide to storing research peptides. This product is sold for laboratory research use only. It is not a medicine or supplement and is not for human or veterinary use.
